PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG029944.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family NF-YC
Protein Properties Length: 282aa    MW: 32104.7 Da    PI: 5.0953
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG029944.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC58.81.2e-186861898
        NF-YC 18 nhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivpr 98
                 ++++P arikki+++dedv +i+  +P l+ska elf+ +l  r++  + +   +tl+   ++++v+  ++fdfl +iv +
  CCG029944.1  6 DTRFPAARIKKIMQTDEDVGKIAMAVPLLVSKALELFLQDLCDRTYEITLKRGAKTLNSLHLKQCVQTFNVFDFLREIVSK 86
                 5789*************************************************************************9976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.104.5E-26372IPR009072Histone-fold
SuperFamilySSF471132.92E-19488IPR009072Histone-fold
PfamPF008081.4E-19871IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
MRKKLDTRFP AARIKKIMQT DEDVGKIAMA VPLLVSKALE LFLQDLCDRT YEITLKRGAK  60
TLNSLHLKQC VQTFNVFDFL REIVSKVPDL GGPDAAFDEH GIAKRRKVAD DEDNYSDEER  120
NRSRRHETTQ TSSSGRGRGR GRGRGRGRGR GTRPMERETA AQDGKFEDDP DIVHHDDKHS  180
PNLGRLDKEY EPEDFKDNIP AGRNLRTPVH DFDLNLDLDE NGETKPVLAS VPASYSTKPI  240
PELKHEEVPG WSLADIERMD IDPIQLANLN TRIDEEDYDE ED
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_A1e-23272575Transcription Regulator NC2 alpha chain
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1139149RGRGRGRGRGR
2141150RGRGRGRGRG
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011042017.10.0PREDICTED: dr1-associated corepressor-like isoform X2
TrEMBLB9GEN51e-133B9GEN5_POPTR; Uncharacterized protein
STRINGPOPTR_0001s23260.11e-120(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17283491
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G12480.12e-66nuclear factor Y, subunit C11